WorkationBase/Jobs/Creative Strategist
RB

Creative Strategist

Ramen Bae
AmerikaAmerika-TZ
execeducationstrategycustomer supportcopywritingmarketingtravelspeech

Stellenbeschreibung

Creative Strategist - Ramen Bae


ABOUT RAMEN BAE


Ramen Bae is the original dried ramen toppings company on a mission to level up the ramen category.


We started three years ago as a passion project because we wanted better instant ramen toppings and couldn’t find anything like it. Since then, we’ve gone viral, built a loyal fan base, grown to over 400,000 customers, and recently launched protein ramen. We’re still just getting started.


We’re a small, fast-moving team of builders who take ownership, move quickly, and figure things out as we go. We’re looking for another like-minded person who is excited to help us build the next great ramen brand.


ABOUT THE ROLE


Ramen Bae is looking for a Creative Strategist to build and lead the creative engine behind our DTC ramen brand.


This person will own performance-driven creative across paid social, with Meta currently being our largest channel. You’ll be responsible for understanding our products, customers, audience awareness stages, and performance data, then turning those insights into ad concepts, hooks, scripts, creator briefs, and video assets that convert.


This role sits at the intersection of performance marketing, creative strategy, consumer psychology, and execution. The ideal candidate is analytical enough to understand what is working and why, creative enough to find new angles that break through, and scrappy enough to move quickly from idea to launch.


This is a high-impact role with significant room for leadership and growth. You’ll work closely with the CMO and growth team to build a repeatable system for producing high-performing creative at scale.


RESPONSIBILITIES


Creative Strategy


• Own creative strategy across paid social and performance marketing channels, with a strong focus on Meta.

• Build and manage a repeatable creative testing framework across hooks, formats, scripts, offers, concepts, personas, and audience segments.

• Develop creative angles based on customer pain points, product benefits, trends, competitor research, customer reviews, and performance data.

• Think through the full customer journey, from problem-unaware audiences to highly aware, ready-to-buy customers.

• Own the pipeline of performance video assets, including UGC, creator-led ads, founder-led content, product demos, recipe content, narrative ads, comparison ads, and social-first concepts.

• Analyze creative performance to identify winning patterns, scalable concepts, and opportunities for improvement.

• Help improve ROAS, CAC, conversion rate, and revenue through stronger creative strategy and execution.


Creative Production & Execution


• Manage the creative process from concept to brief, scripting, production, editing, feedback, and final delivery.

• Write compelling hooks, scripts, ad briefs, and creator directions that are clear, strategic, and performance-oriented.

• Direct creators, editors, freelancers, agencies, and internal team members to produce high-performing assets.

• Build systems for creative ideation, testing, asset organization, feedback, iteration, and reporting.

• Ensure creative is both on-brand and built to perform in paid social environments.

• Stay on top of social trends, competitor ads, creator formats, and emerging creative opportunities.

• Jump in wherever needed to keep creative moving, whether that means writing scripts, reviewing edits, sourcing creators, organizing assets, or helping bring concepts to life.


Strong bonus: Ability to shoot and edit your own creator-style content.


REQUIREMENTS


• 3+ years of experience in creative strategy, performance marketing, paid social creative, DTC ecommerce, or a performance creative agency.

• Strong understanding of paid social creative, especially for Meta.

• Deep understanding of what makes video ads convert, including hooks, pacing, messaging, storytelling, offers, and visual structure.

• Experience building or contributing to a creative testing system that generates new concepts consistently.

• Strong analytical ability and comfort reviewing performance data to understand what is working, why it is working, and what to test next.

• Ability to deeply understand a product, customer persona, and the emotional and functional reasons people buy.

• Strong creative instincts, copywriting ability, and visual taste.

• Comfort developing new creative angles based on product benefits, customer pain points, cultural trends, competitor research, and performance insights.

• Highly self-motivated, resourceful, and able to take ownership without needing constant direction.

• Comfortable working on a small team where everyone is expected to be hands-on, proactive, and accountable.

• Strong collaborator who can work effectively with internal team members, creators, editors, freelancers, and agencies.

• Curious, adaptable, eager to learn, and comfortable moving fast in a startup environment.


WHO THIS ROLE IS PERFECT FOR


This role is perfect for someone who loves combining data, creativity, and execution.


You want to understand why an ad works, not just whether it worked. You can look at performance data, customer reviews, product benefits, and social trends, then turn those insights into creative ideas that drive growth.


You’re comfortable leading the creative process, but you’re also willing to execute. You bring a strong creative point of view, a deep interest in performance marketing, and the hustle to move quickly from idea to launch.


This is an opportunity to help shape the creative engine of a growing DTC brand and play a key role in how Ramen Bae reaches, converts, and retains customers.


COMPENSATION & BENEFITS


• $80,000–$115,000 base salary, based on experience and leveling

• Equity options in a profitable, rapidly growing company

• Flexible PTO and paid holidays

• Health, dental, and vision benefits

• Fully Remote




Please mention the word **COHERENCE** and tag RMTczLjI0OS4yOS40 when applying to show you read the job post completely (#RMTczLjI0OS4yOS40). This is a beta feature to avoid spam applicants. Companies can search these words to find applicants that read this and see they're human.

Quelle: Remote OK